PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 948aa    MW: 106243 Da    PI: 5.3184
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25413.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-183682148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde+l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
       KFK25413.1 36 RGQWTAEEDEILRKAVHSFKGKNWKKIAEYFK-DRTDVQCLHRWQKVL 82
                     89*****************************9.************986 PP

2Myb_DNA-binding62.11.2e-1988134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde ++++++++G++ W+tIar ++ gR +kqc++rw+++l
       KFK25413.1  88 KGPWTKEEDEMIIQLIEKYGPKKWSTIARFLP-GRIGKQCRERWHNHL 134
                      79******************************.*************97 PP

3Myb_DNA-binding431e-13140182145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gR+++ +k++w+
       KFK25413.1 140 KEAWTQEEELVLIRAHQIYGNR-WAELTKFLP-GRSDNGIKNHWH 182
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2943182IPR017930Myb domain
SMARTSM007171.2E-153584IPR001005SANT/Myb domain
PfamPF002492.1E-163682IPR001005SANT/Myb domain
SuperFamilySSF466892.15E-153792IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-233790IPR009057Homeodomain-like
CDDcd001674.17E-143982No hitNo description
PROSITE profilePS5129432.77483138IPR017930Myb domain
SuperFamilySSF466891.12E-3185181IPR009057Homeodomain-like
SMARTSM007172.1E-1987136IPR001005SANT/Myb domain
PfamPF002498.3E-1888134IPR001005SANT/Myb domain
CDDcd001672.99E-1790134No hitNo description
Gene3DG3DSA:1.10.10.608.8E-2891138IPR009057Homeodomain-like
SMARTSM007171.5E-12139187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-19139189IPR009057Homeodomain-like
PROSITE profilePS5129418.094139189IPR017930Myb domain
PfamPF002499.4E-12140182IPR001005SANT/Myb domain
CDDcd001679.35E-10142182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    Send to blast
MESECTPIST PPEGLIEGNT KTRHGRTSGP ARRSTRGQWT AEEDEILRKA VHSFKGKNWK  60
KIAEYFKDRT DVQCLHRWQK VLNPELVKGP WTKEEDEMII QLIEKYGPKK WSTIARFLPG  120
RIGKQCRERW HNHLNPAINK EAWTQEEELV LIRAHQIYGN RWAELTKFLP GRSDNGIKNH  180
WHSSVKKKLD SYMASGLLDQ YQAMPLAPYE RSSTLQSTFM QRTIDENDCL SGQVENEMEN  240
HQNASMVGCS LSARDYPNGV VNMGQHFYPC ENSHENAQAA YHPDQYFFPE LEDISVSISE  300
VSYDMEDCSQ FRDHNVSASS SQDYHFDFQE LSDISLEMRH NMSDVQMPYT NESKESTMGA  360
LNSTGNIDVA TCTNPANVLT SETECCRILF PDQESGGLSV STSLTQELNE VDQADSRVPT  420
FGASASDSQI SEATKSPMQS SSSRFIAKAA SGKATLRPAP LIISPDKYAK KSSGLICHPF  480
EATPKCTTNP NGSFICIDDP SSSCVDEGTN NSSEEDQSYH VNDSKKLVAV NDFASLAEVK  540
PQSLPKHEPN MTSEEHHEDI GASSSHCFPS LDVPVFSSDL LQSKNDLLHD YSPLGIRKLL  600
MSTMTCMSPL RLWESPTGKK TLVGAKSILR KRTRDLLTPL SEKRCEKKLE TDIAASLAKD  660
FSRLDVMFDE SENRESISGN SNSGILGERE NHYQILIGEG KETMHIRKSL EKAVQTCMEA  720
NVREKDASEP YVENAENFSG VLSENNTNKS ALSPPGQSIT KAEKAQLSTP RNHLQRTFMA  780
TSNKEQLCLV INSPSRVRNT EGHLVDSETS NENFSIFCGT PFRRSLESPS AWKSPFYVNS  840
LLPSPRFDTE ITIEDMGYIF SPGERSYEGI GVMTQRNEHT NAFAAFTDAM EVSLSPSTDY  900
AMQKKELDKE NNDPLVAERR VLDFNDCESP IKATEQVSSS YNLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-69361896159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-69361896159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719750.0AF371975.2 Arabidopsis thaliana putative c-myb-like transcription factor MYB3R-4 (MYB3R4) mRNA, complete cds.
GenBankAY5196500.0AY519650.1 Arabidopsis thaliana MYB transcription factor (At5g11510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399657.10.0hypothetical protein EUTSA_v10012583mg
TrEMBLA0A087G6B10.0A0A087G6B1_ARAAL; Myb-related protein 3r-1-like
STRINGfgenesh2_kg.6__1121__AT5G11510.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4